PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G229000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 475aa    MW: 50309.5 Da    PI: 9.7196
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G229000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS304.42.7e-93924742374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++l+l+cA+ ++ gdl +a+++   l   asp++d+  Rla +f++ALa r        +  ++p   s      +  a+ +f+++ P+l+
  Sevir.4G229000.1.p  92 RDLVLACADLLQRGDLPAARRAAGVLLSAASPRADAADRLAYHFARALALRADARAAAAAGRVAPGLVSAAARPASSGAYLAFNQIAPFLR 182
                         6799*************************************************98888888888888888888999999999********* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         f+hltaNqaIl+aveg++r+Hi+D+d+ +G+QWp+Llqa+a+R+   +gpp++RiTg g+    ++++l +tg+rL+ fA+++++pf+f++
  Sevir.4G229000.1.p 183 FAHLTANQAILDAVEGARRIHILDLDAAHGVQWPPLLQAIAERAdpaAGPPEVRITGAGA----DRDTLLRTGSRLRAFARSIQLPFHFTP 269
                         *******************************************988888***********....9************************** PP

                GRAS 181 l..............vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sF 253
                         l               + ++++    +L+++p+E+laVn+v+ lh+l    +  ++e  ++Lk vk + P vv+v+e+e+  ++     ++
  Sevir.4G229000.1.p 270 LllscaathhhevagGSATTASSAATSLELHPDETLAVNCVMFLHKLG---G--QDEVAAFLKWVKAMAPAVVTVAEREMIGGGYdridDL 355
                         *99987766655433233444447899********************8...2..233578*******************76644334559* PP

                GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                          +r + a+++ysa+f++lea++p+ s+er  vE+e+lgrei+  +  +g +     + le+W ++ ++aGF + pls +a++qa+lllr +
  Sevir.4G229000.1.p 356 PQRAAVAMDHYSAVFEALEATVPPGSRERLAVEQEVLGREIEASLGPAGGR---WWRGLERWGAAARAAGFAARPLSAFAVSQARLLLRLH 443
                         **********************************************99987...7899********************************* PP

                GRAS 345 k.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         + s+gy v+e +g+ +lgW++rpL+svS+W+
  Sevir.4G229000.1.p 444 YpSEGYLVQEARGACFLGWQTRPLLSVSSWQ 474
                         ******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.08765453IPR005202Transcription factor GRAS
PfamPF035149.2E-9192474IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010014Biological Processmeristem initiation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MHALLLLLHP LMLLACHHRR LRPPPPPLIR GLAPVKKKLQ RGGTVGAMLG SLHHHHHHHH  60
SSSSSDTDNN NDNKNGSNSS GGVLAAAAPS ARDLVLACAD LLQRGDLPAA RRAAGVLLSA  120
ASPRADAADR LAYHFARALA LRADARAAAA AGRVAPGLVS AAARPASSGA YLAFNQIAPF  180
LRFAHLTANQ AILDAVEGAR RIHILDLDAA HGVQWPPLLQ AIAERADPAA GPPEVRITGA  240
GADRDTLLRT GSRLRAFARS IQLPFHFTPL LLSCAATHHH EVAGGSATTA SSAATSLELH  300
PDETLAVNCV MFLHKLGGQD EVAAFLKWVK AMAPAVVTVA EREMIGGGYD RIDDLPQRAA  360
VAMDHYSAVF EALEATVPPG SRERLAVEQE VLGREIEASL GPAGGRWWRG LERWGAAARA  420
AGFAARPLSA FAVSQARLLL RLHYPSEGYL VQEARGACFL GWQTRPLLSV SSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4911947431375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP8765580.0KP876558.1 Saccharum hybrid cultivar ROC22 monoculm 1 (MOC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965904.20.0PREDICTED: protein MONOCULM 1-like
RefseqXP_012700859.10.0PREDICTED: protein MONOCULM 1-like
SwissprotQ84MM90.0MOC_ORYSJ; Protein MONOCULM 1
TrEMBLK3Y1K30.0K3Y1K3_SETIT; Uncharacterized protein
STRINGSi008068m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36533479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-71GRAS family protein